Спутник технологический. INS 1C. [Редактировать]

КА INS-1C это наноспутник, который был разработан ISRO. В качестве полезной нагрузки на космическом аппарате установлен малый мультиспектральный сенсор. 

Дополнительная классификация

1Тип орбиты - НОО
2Тип оператора(владельца) - государственный
3Страна оператор(владелец) - Индия
4Страна производитель - Индия

Технические характеристики

1Масса, кг11
2Платформа 1xINS-1

Информация об удачном запуске

1Космодром Шрихарикота
2Дата пуска2018-01-12
3Полезная нагрузка 1xCartosat 2F
4Полезная нагрузка 1xMicrosat-TD
5Полезная нагрузка 1xLEO Vantage 1
6Полезная нагрузка 1xCBNT 2
7Полезная нагрузка 1xICEYE X1
8Полезная нагрузка 1xINS 1C
9Полезная нагрузка 1xArkyd 6A
10Полезная нагрузка 1xCICERO 7
11Полезная нагрузка 1xCorvus-BC 3
12Полезная нагрузка 1xLemur-2 68
13Полезная нагрузка 1xLemur-2 69
14Полезная нагрузка 1xLemur-2 70
15Полезная нагрузка 1xLemur-2 71
16Полезная нагрузка 4xFlock
17Полезная нагрузка 1xMicroMAS 2a
18Полезная нагрузка 1xPicSat
19Полезная нагрузка 1xCNUSail 1
20Полезная нагрузка 1xCANYVAL-X 1
21Полезная нагрузка 1xCANYVAL-X 2
22Полезная нагрузка 1xKAUSAT 5
23Полезная нагрузка 1xKHUSAT 3
24Полезная нагрузка 1xDemoSat
25Полезная нагрузка 1xTyvak 61C
26Полезная нагрузка 1xFox 1D
27Полезная нагрузка 1xSTEP Cube Lab
28Полезная нагрузка 1xSpaceBEE 1
29Полезная нагрузка 1xSpaceBEE 2
30Полезная нагрузка 1xSpaceBEE 3
31Полезная нагрузка 1xSpaceBEE 4
32Ракета-носитель 1xPSLV-XL

Найдено 1000 документов по запросу «INS 1C». [Перейти к поиску]

Дата загрузки: 2017-12-26
Скачать документ
Скачать текст
... 2007-021A Astra 1D Astra 1C, i=4.75 RASCOM-QAF 1R Hot... VOLNA-25 STATSIONAR-24 TURKSAT-1C TURKSAT-K3 TURKSAT-C50E THAICOM...(93.5) INSAT-2M(93.5) INSAT-1C INSAT-EK93.5 INSAT-EK93.5R... CHN CHN CHN CHN USA INS INS INS INS G G J J J 110.00 E USA USA J J J J J 110... 2011 113.00 E INS KOR KOR INS KOR INS KOR 113.20 E CHN... 116.20 E KOR 118.00 E INS INS INS INS INS 119.00 E CHN 119.50... CHN CHN CHN 123.00 E INS 123.50 E CHN CHN 124... USA RUS RUS J J 146.00 E INS INS 148.00E MLA 150.00 E J USA J J 150.50 E INS 152.00 E AUS AUS AUS... EAST SBTS C1 SISCOMIS-3 B-SAT-1C MILSTAR 8 ASA SIMON BOLIVAR 2 YAMAL... 2000-007A 2006-007A Hispasat 1C Spainsat 30.02W 29.95W...

Дата загрузки: 2017-12-26
Скачать документ
Скачать текст
... VOLNA-25 STATSIONAR-24 TURKSAT-1C, suspended TURKSAT-K3, suspended. TURKSAT... 2015-073A Cosmos 2513 Chinasat 1C 80.2 E 81.5 E 2013-038B Insat... 2015-041A Insat 4A IRNSS-1C, i=4.8 GSat-12 GSat-10 Gsat... E USA 108.00 E INS INS INS 108.20 E G HOL INS LUX 109.00 E G 109...(111.5)E 113.00 E INS KOR KOR KOR INS KOR INS 115.50 E CHN... 116.20 E KOR 118.00 E INS INS INS INS INS 119.50 E THA 120.00... 122.20 E CHN 123.00 E INS PALAPA-B2 KOREASAT-113E KOREASAT... USA RUS RUS J J 146.00 E INS INS J 148.00 E MLA MLA MLA 150.00E USA J J J 150.50 E INS 152.00 E AUS AUS AUS....00 W USA SBTS C1 B-SAT-1C SISCOMIS-3 SBTS B1 MILSTAR 8 B-SAT... 2008-044A Brasilsat B4 Hispasat 1C AMC-9, GE12 AMC-9, (GE 12...

Дата загрузки: 2017-12-26
Скачать документ
Скачать текст
..., North Africa 1993-031A Astra 1C, i=1.21 4.74 E 52,55 1998...-25 9-13 USMB-8 35 TURKSAT-1C 52, 57 1995-023A Intelsat...-12 DEF-R-SAT-3A INSAT-1C INSAT-2 (93.5) INSAT-2B INSAT... 106.50 E USA 107.70 E INS ASIABSS CHINASAT-46 FY-2A... 35 43, 47 108.00 E INS INS CHN PALAPA-B1 PALAPA-C2... CHN IND 113.00 E KOR INS INS INMARSAT-3 POR WEST BS-3N...-57 KOR KOR 118.00 E INS 120.00 E J THA THA 121... E 143.50 E 144.00 E J KOR J J INS 145.00 E RUS RUS RUS USA J 146.00 E INS 148.00 E MLA MLA 150... BSS) 33-57 ● Hispasat 1C HISPASAT-1C 52, 55 ● 2000-007A Hispasat 1C 30.04W C1 HISPASAT-2A ...-2C3 KU 52-57 ● Hispasat 1C HISPASAT-2D KU 52-57...

Дата загрузки: 2017-12-26
Скачать документ
Скачать текст
... 1993-031A 2010-037B Astra 1C, i=6.3 Rascom-QAF 1R 2.0 E 2.9 E C2.1 C1... VOLNA-25 STATSIONAR-24 TURKSAT-1C 1999-005A TURKSAT-K3 TURKSAT... INS INS INS INS INS G G J J J USA USA J J J J J CHN CHN CHN CHN CHN IND INS KOR KOR INS KOR KOR INS CHN CHN CHN... CHN CHN KOR KOR KOR INS INS INS INS INS INS THA THA THA THA THA... 122.20 E CHN 123.00 E INS 123.50 E CHN CHN 124....00 E JRUS USA J J 146.00 E INS INS J 148.00E MLA MLA MLA 150.00 E J USA J J J 150.50 E INS 152.00 E AUS AUS AUS... B1 SBTS C1 SISCOMIS-3 B-SAT-1C MILSTAR 8 B-SAT-1J ASA SIMON... 2008-044A Brasilsat B4 Hispasat 1C AMC-9 (GE-12) Nimiq 4 Nimiq...

Дата загрузки: 2017-12-26
Скачать документ
Скачать текст
... 2009-008B 2007-021A Astra 1C, i=5.57 RASCOM-QAF 1R Eutelsat... VOLNA-25 STATSIONAR-24 TURKSAT-1C TURKSAT-K3 TURKSAT-C50E THAICOM....50 E USA 107.70 E INS 108.00 E INS INS INS 108.20 E G ASIASAT-CK... E IND 113.00 E INS KOR KOR INS KOR KOR INS 115.50 E CHN... 116.20 E KOR 118.00 E INS INS INS INS INS INS 119.50 E THA 120.00... CHN CHN CHN 123.00 E INS 123.50 E CHN 123.50... 146.00 E J USA J J 146.00 E INS INS J 148.00E MLA MLA MLA 150.00 E J USA J J 150.50 E INS 152.00 E AUS AUS AUS... B1 SBTS C1 SISCOMIS-3 B-SAT-1C MILSTAR 8 B-SAT-1J SIMON BOLIVAR... 236, SDS 3 F7, i=4.48 Hispasat 1C Spainsat 30.4 W 30.0 W 30.0 W 2C2...

Дата загрузки: 2017-12-26
Скачать документ
Скачать текст

Дата загрузки: 2017-12-26
Скачать документ
Скачать текст
...; 9A; 10B. Lösungen aus Runde 2: 1C; 2B; 3A; 4C; 5B; 6A... sein, der zum ersten Mal ins All fliegt, sondern der schon.... Warum muss der Mensch überhaupt ins All fliegen? Was kann er...: Bei der Frage, warum Menschen ins All fliegen sollen, gibt es... schickt man nicht einfach Roboter ins All? Thomas Reiter: Auch wenn... Hans Schlegel als nächster Deutscher ins All starten wird, alles Gute... Astronauten angesetzt zu haben. Die ins Leben gerufene Kommission konnte die... werden, der zum zweiten Mal ins All flog. Der Start des... Jiyuan. ersten geostationären Kommunikationssatelliten ins All. Es war der DFH... Wettersatellit mit der Bezeichnung FENGYUN 1C (Bild oben), der sich in... wird derzeit von seiner Tochter ins Deutsche übersetzt und hoffentlich noch... des Steuerzahlers ein hochkomplexes Industriekonsortium ins Leben rufen, das dann beginnen...

Дата загрузки: 2017-10-24
Скачать документ
Скачать текст
...-1b ECE-1c-GFP C-terminal GFP-tagged ECE-1c ECE-1c-mCherry C-terminal mCherry-tagged ECE-1c ECE-1d...-length ECE-1b and ECE-1c ....................................................... 77 2.22.1. Preparation of ECE... the rat pancreatic β-cell line, INS-1E. ........ 120 3.3. Discussion ............................................................................................................. 125 3.3.1. GLP... HEK-GLP-1R cells and INS-1E cells. .............................................................. 139 4.2.3. High concentrations... HEK-GLP-1R cells and INS-1E cells. .............................................................. 167 4.2.7. Sustained cAMP... both HEK-GLP-1R and INS-1E cells........................................................ 173 4.2.8. Sustained ERK... HEK-GLP-1R cells and INS-1E cells. ................................. 179 4.2.9. GLP-1 7-36... compound 2-evoked cAMP production in INS-1E cells. .......................................................................................................................... 219 5.2.5. GLP-1 9-36... both HEK-GLP-1R and INS-1E cells. ............................................................................... 221 5.3. Discussion ............................................................................................................. 224... different cell lines used. In INS-1E cells, glucose/GLP-1-induced... has also been examined in INS-1E cells. Here, 1 h pre-treatment... response to GLP-1 stimulation in INS-1E cells (Sonoda et al...-1R signalling. For example, in INS-1E cells, GLP-1 evoked rapid..., MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFH ECE-1b, MEALRESVLHLALQMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFH ECE-1c, MPLQGLGLQRNPFLQGKRGPGLTSSPPLLPPSLQVNFH ECE-1d, MMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFH Fig... both HEK-GLP-1R and INS-1E cells, looking at specific... but with 200 µg/mL G418. INS-1E cells were cultured in... both HEK-GLP-1R and INS-1E cells. HEK-GLP-1R... 125I-exendin 9-39 amide. For INS-1E cells at 80% confluence.... HEK-GLP-1R cells or INS-1E cells were treated as... µL (HEK-GLP-1R) or 350 µL (INS-1E) of 0.05 nM 125... µL (HEK-GLP-1R) or 500 µL (INS-1E) of ice-cold buffer...-GLP-1R or 200 µL for INS-1E). The plates were then... µL (HEK-GLP-1R) or 200 µL (INS-1E) of 0.1 M HCl. The samples... (HEK-GLP-1R) or 4 mL (INS-1E) Safefluor scintillant. 2.9. Western blot... or in a pancreatic β-cell line, INS-1E, expressing native GLP-1Rs... rat pancreatic β-cell line, INS-1E. In INS-1E cells, 100 nM... recovery after ligand removal. Ai. INS-1E cells were stimulated with... that of basal (0 min). Bi. INS-1E cells were stimulated with.... B. In the absence of IBMX, INS-1E cells were pre-treated... inhibition of endosomal acidification in INS-1E cells. A. Experimental protocol. Cells...-1R cells were confirmed in INS-1E cells expressing native GLP... explored in pancreatic β-cell line, INS-1E (Baggio et al., 2004... GLP-1 7-36 amide exposure in INS-1E cells (Fig In HEK... HEK-GLP-1R cells and INS-1E cells (Fig, Fig 3.2.7. and... HEK-GLP-1R cells and INS-1E cells. Experiments in Chapter... untransfected cells (Fig 140 In INS-1E cells, as previously demonstrated...-1R-mediated cAMP response in INS-1E cells. A. Experimental protocol. B. Cells... mM (Fig, B). A similar experiment in INS-1E cells was inconclusive as... HEK-GLP-1R cells and INS-1E cells. Radioligand binding was... high glucose concentrations (Fig In INS-1E cells, as shown previously...-surface GLP-1R binding in INS-1E cells. Ai. Cells were... both HEK-GLP-1R and INS-1E cells. In HEK-GLP... initial response (Fig Similarly, in INS-1E cells, treatment with SM19712... and the cellular cAMP determined. C. INS-1E cells were pre-incubated... HEK-GLP-1R cells and INS-1E cells. In HEK-GLP... control (without SM19712) (Fig In INS-1E cells, the pERK response... amide-mediated ERK activation in INS-1E cells. Cells were pre...-1 7-36 amide-induced ERK activation. INS-1E cells were pre-incubated... of the extracellular ligand in INS-1E cells. Cells were pre... the same immunostaining method in INS-1E cells, pERK levels were... amide-evoked ERK activation in INS-1E cells determined by immunostaining...-cellular distribution following ligand removal. INS-1E cells were pre-incubated... HEK-GLP-1R cells and INS-1E cells. Previous work has... distribution of GFP-ECE-1c and ECE-1c-GFP (Kuruppu et al... both HEK-GLP-1R and INS-1E cells. 205 5.2. Results 5.2.1. GLP... 2-evoked cAMP production in INS-1E cells. In INS-1E cells, GLP... 2-evoked cAMP production in INS-1E cells. A, B. INS-1E cells were stimulated... both HEK-GLP-1R and INS-1E cells. In HEK-GLP... the individual responses (Fig 5.2.5.A). In INS-1E cells, stimulation for 5 min... both HEK-GLP-1R and INS-1E cells. HEK-GLP-1R cells (A) or INS-1E cells (B) were stimulated for..., this was not apparent in INS-1E cells (Fig 5.2.4.) suggesting that... on ERK activation, particularly in INS-1E cells. Indeed, 10 μM GLP... true for compound 2. Thus, in INS-1E cells, compound 2 (10 μM) stimulated... both HEK-GLP-1R and INS-1E cells. Receptor recovery requires...

Дата загрузки: 2017-06-15
Скачать документ
Скачать текст
... 4 5 3b 2 3a 4 5 3c 6 1 1 2 3.1 3.2 3.3 3.4 3.5 3.6 3.7 4.1 5 6 1 2 3 4 5 6.1 6.2 6.3 6.4 6.5 6.6 6.7 6.8 6.9 7 8.1 8.2 9 1 2 3 4 1 2 3 4 5 6 7 8 1a 1b 1c Shareholder Resolution: Preparation of Health... 1.07 2 5 1.01 1.08 3 4 O.1 O.2 O.3 O.4 O.5 E.1 1 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 2.1 3.1 3.2 1b 1a 1c 1d 1e 5 1f 1g To... 2 3 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 2 3 4 5 6 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 1.1 2 3 1 2 3 4 5 6 7 8 9 10 11 12 1a 1b 1c 2a 2b 2c 2d 2e... 1.02 1.03 2 3 1a 1b 1c 2 3 4 1a 1b 1c ARIAD PHARMACEUTICALS INC ARIAD... AGM 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 1.1 1.11 1.12 2 3 4 1 2 3 4 5 6.1 6.2 6.3 6.4 6.5 6.6 7 8.a 8.b 8.c 8.d 8.e 8.f 8.g 8.h 8.i 1a 1b 1c 1d 2 3 4 5 1 2 3 4a 4b 5 6 7 8a 8b... 13 14 15 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 2 3 1 2 3.1 3.2 3.3 3.4 3.5 3.6 3.7 4.1 4.2 5 6 7 1 2 1a 1b 1c 1e 1f 1h 1i 2 3 1d... AGM AGM AGM AGM AGM 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 1.1 2 3 1 2 3 4 1 1 1.1 1.2 1.3 3 1.4 1.5 1.6 1.7 1.8 2 4 1c 1b 1h 1i 1a 1d... PACIFIC INS (GROUP) CO CHINA PACIFIC INS (GROUP) CO CHINA PACIFIC INS (GROUP) CO CHINA PACIFIC INS (GROUP) CO CHINA PACIFIC INS (GROUP) CO CHINA PACIFIC INS (GROUP) CO CHINA PACIFIC INS (GROUP) CO CHINA PACIFIC INS (GROUP) CO CHINA PACIFIC INS (GROUP) CO CHINA PACIFIC INS (GROUP) CO CHINA PACIFIC INS (GROUP... For Oppose For CHINA PACIFIC INS (GROUP) CO CHINA PETROLEUM & CHEM... A.1 A.2 A.3 A.4 B.1 B.2 B.3 B.4 B.5 B.6 B.7 1.01 1.02 3 2 1.03 4 5 6 1 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 3.1 4 1a 1b 1c 1d To elect Yan Wenlong... AGM AGM AGM 4 5 6 7 8 1 2 3 4 5 6.1 6.2 1a 1b 1c 2 3 1.5 1.6 1.7 1.8 1.1 1.2 1.3 1.4 1.9 1.1 1.11 1.12 2 3 4 1 2 3 4 5 6 1 2 1 2 3 4 5 6 7 8 9 10 11 12 1a. 1b. 1c. Shareholders' Proposal Shareholders' Proposal Shareholders... 1.08 1.09 2 3 1.02 1a 1b 1c 2 3 1 2 3.a 3.b 3.c 3.d 3.e 4 5 6 7.a 7.b 8 9 1 2 3.a 3.b 3.c 3.d 4 5 6 7 8 Approve the dividend Appoint the... CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS CO LTD 155 27/06/... INS CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS... 13 14 1 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 3 4 1a 1b 1c 4 3 4 5 1a 1b 1c 1d 1e 1f 1g... 1l 2 1d 1 2 3 4 5 6 1a 3 1b 1c 2 1a 1b 1c 2 3 1d 1e 1f 1g... AGM AGM 2.1 2.11 3.1 4 5 6 7 8 1.1 1.2 2 3.1 3.2 4.1.1 4.1.2 4.1.3 4.1.4 4.1.5 4.1.6 4.1.7 4.1.8 4.1.9 4.2.1 4.3.1 4.3.2 4.3.3 4.3.4 4.4 4.5 1b 1a 1c 1d 1e 1f 1g 1h... 1.09 2 3 1.08 1.1 1.2 1.3 2 3 4 1.2 1.4 1.5 1.6 1.7 1.8 1.9 1.1 1.11 2 3 1.1 1.3 1a 1b 1c 1d 2 3 1 2 3.a To elect Mr Jos... AGM 7 8 9 10 1.1 1.2 1.3 2 3 4 1 2 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 1.1 1.11 1.12 2.1 1 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 2.1 3.1 4 5 1 2.1 2.2 2.3 2.4 2.5 2.6 2.7 1b 1c 1a 3 1d 2 4 1.1 Issue shares with... INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS... AGM AGM AGM AGM 2.7 2.8 2.9 2.1 3 1 2.1 2.2 3.1 3.2 4 1 2 3.1 3.2 3.3 3.4 3.5 3.6 3.7 3.8 3.9 4.1 4.2 4.3 4.4 A.1 A.2 A.3 B.1 B.2 B.3 B.4 B.5 1 2 3.1 3.2 3.3 3.4 3.5 3.6 3.7 4 1a 1c 1d 1e 1f 1g 1h... AGM AGM 1.5 1.6 1.7 1.8 1.9 1.1 1.11 1 2.1 2.2 2.3 2.4 2.5 3.1 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 2.1 2.2 1a 1b 1c 1d 1e 1f 1g 1h... 1.08 1.09 1.1 3 2 1.11 1 2.1 2.2 2.3 2.4 2.5 2.6 2.7 3.1 4 1.1 1.2 1.3 2 3 1.4 1.5 1.6 1.7 1.8 4 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 2 3 1 2.1 2.2 2.3.1 2.3.2 2.4 3 4 5 1a. 1b. 1c. 1d. Elect Susan Clark-Johnson... AGM 1.5 1.6 1.7 1.8 1.9 1.1 1.11 1.12 2 1 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 3 1 2 3 4 E,5 1 2.1 2.2 2.3 2.4 2.5 2.6 3.1 3.2 1a 1b 1c 1d 1e 1h 1f 1g... 8H 8B 8I 1.1 1.2 1.3 1.4 1.6 1.7 1.8 1.9 1.1 2 3 1.5 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 2.1 1a 1b 1c 1d 1e 1f 1g 3 1h... 1f 1g 1h 1i 3 1c 2 1a 4 1b 1c 1d 1e 1f 1g...

Дата загрузки: 2017-06-15
Скачать документ
Скачать текст
... 19 20 21 2 3 4 1.a 1.b 1.c 1.d 1.e 1.f 1.g 1.h 1.i 1.j 1.k 1.l 1.m 1 2 3 4 5 6 7 8 9 2 3 4 1a 1b 1c Issue shares for cash and... AGM AGM AGM 1.5 1.6 1.7 1.8 1.9 2 3 1.1 1.2 1.3 1.4 1.5 1.6 1.7 2 3 2 3 4 1a 1b 1c 1d 1 2 3 4 5 6 7 8 9 10 11 12 13... 1 2 3 6 4.a 4.b 5.a 5.b 5.c 7.A 7.B 1 1 2 3 4 5 1 2 3 6 7 8 9 4.i 4.ii 5.i 5.ii 5.iii 1 2 3 4 5 1a 1b 1c 1 2 3 4 5 6 7 8 9 10 11 93 Elect Bradford... 1.07 1.08 1.09 2 3 1 2 3.1 3.2 3.3 3.4 3.5 3.6 3.7 4.1 4.2 5 6 7 8 2 3 1a. 1b. 1c. Elect Michael A. Friedman Elect Gilla... AGM AGM 1k 1 2.1 2.2 2.3 2.4 2.5 2.6 2.7 3.1 4 2 3 4 5 1a 1b 1c 1 2 3 4.1 6 7 8 9 4.b 5.a 5.b 5.c 5.d 1 2 3 4 5 6 7 8 9 10 11 1.01 1.02 1.03... AGM AGM AGM AGM 1c 2 1a 1b 1c 1d 1e 1f 1g... 4h 1 2 3 4 1 2.1 2.1 2.11 2.12 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 3.1 4 1.1 1.2 1.3 2 3 2 3 4 5 6 1a 1b 1c Amend Article 5 to Reflect Changes... INS CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS CO LTD DAI-ICHI LIFE INS... AGM AGM 3.7 3.8 3.9 4.1 4.2 5 2 3 4 1a 1b 1c 2 3 4 1a 1b 1c 1d 1e 1f 1g... AGM AGM AGM 2 3 4 5 6 7.1 7.1 7.2 7.3 7.4 7.5 7.6 7.7 7.8 7.9 1 2 3.1 3.2 4 5 6.1 6.2 6.3 6.4 6.5 7 8 2 3 4 1a 1b 1c 1d 1e 1f 1g 1h... AGM 1i 1 2 3 4 5 6 2 3 4 1a 1b 1c 2 3 4 5 1a 1b 1c 1 Elect Nader H. Sultan Receive... & MARINE INS CO HYUNDAI FIRE & MARINE INS CO HYUNDAI FIRE & MARINE INS CO HYUNDAI FIRE & MARINE INS CO HYUNDAI FIRE & MARINE INS CO... EGM 2 3 5 6 7 8 9 10 11 4 (a) 4 (b) 4 (d) 4 (e) 4 (f) 4 (g) 4 (h) 4 (i) 4 (j) 4 (k) 4(c) 2 3 4 5 1a 1b 1c 1d 1e 1f 1g 1h... 2.14 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 3.1 4 1 2.1 2.1 2.11 2.12 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 3.1 1.1 1.2 1.3 1.4 2 3 2 3 4 1a. 1b. 1c. 1d. 1e. 1f. 1g. 1h... AGM AGM AGM AGM 2.3 2.4 2.5 2.6 2.7 2.8 3 1 2.1 2.2 2.3 2.4 2.5 2.6 2.7 3.1 4 1 2 3 1b 1c 1d 1e 2 3 4 5 MASCO CORP. MASCO... AGM AGM 1a 1b 1c 2 3 1a 1b 1c 1d 1e 1f 1g... INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS... INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS GROUP HLDGS INC MS&AD INS... AGM AGM AGM 5 6 1a 1b 1c 1.1 1.1 1.11 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 2.1 2.2 2.3 1 2 4 5 3.a 3.b 3.c 3.d 6.a 6.b 6.c 1 2.1 2.1 2.11 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 1.1 1.1 1.11 1.12 1.13... INTERNATIONAL SA SAMSUNG FIRE & MARINE INS 18/04/2013 18/04... INS SAMSUNG FIRE & MARINE INS SAMSUNG FIRE & MARINE INS SAMSUNG FIRE & MARINE INS SAMSUNG... 1h 1i 2 3 4 1a 1b 1c 2 3 4 5 1a 1b 1c 1d 1e 1f 1g... 1.03 2 3 4 5 6 1 2 3 4 5 6.1 6.2 6.3 6.4 6.5 6.6 6.7 6.8 1.1 1.2 1.3 1.4 1.5 1.6 1.7 2.1 3 1.02 3 4 1,01 2 3 4 5 6 7 8 1a 1b 1c 595 Set the number of... PLC WHITE MTNS INS GROUP LTD WHITE MTNS INS GROUP LTD 601... Withhold WHITE MTNS INS GROUP LTD WHITE MTNS INS GROUP LTD 23... Corporation Withhold Withhold WHITE MTNS INS GROUP LTD 23/05/2013... Insurance Corporation Withhold WHITE MTNS INS GROUP LTD 23/05/2013... Insurance Corporation Withhold WHITE MTNS INS GROUP LTD 23/05/2013... Insurance Corporation Withhold WHITE MTNS INS GROUP LTD 23/05/2013 AGM 2.05 Withhold WHITE MTNS INS GROUP LTD 23/05/2013... MTNS INS GROUP LTD WHITE MTNS INS GROUP LTD WHITE MTNS INS GROUP LTD WHITE MTNS INS GROUP LTD WHITE MTNS INS GROUP... Withhold Withhold Withhold WHITE MTNS INS GROUP LTD 23/05/2013... Bermuda, Ltd. Withhold WHITE MTNS INS GROUP LTD 23/05/2013... Bermuda, Ltd. Withhold WHITE MTNS INS GROUP LTD 23/05/2013... Bermuda, Ltd. Withhold WHITE MTNS INS GROUP LTD 23/05/2013 AGM 5.01 Withhold WHITE MTNS INS GROUP LTD 23/05/2013... Reinsurance (Bermuda) Ltd. WHITE MTNS INS GROUP LTD 23/05/2013... (Bermuda) Ltd. Withhold WHITE MTNS INS GROUP LTD 23/05/2013... (Bermuda) Ltd. Withhold WHITE MTNS INS GROUP LTD 23/05/2013... (Bermuda) Ltd. Withhold WHITE MTNS INS GROUP LTD 23/05/2013... (Bermuda) Ltd. Withhold WHITE MTNS INS GROUP LTD 23/05/2013... MTNS INS GROUP LTD WHITE MTNS INS GROUP LTD WHITE MTNS INS GROUP... Withhold WHITE MTNS INS GROUP LTD WHITE MTNS INS GROUP LTD 23...) Ltd. Withhold Withhold WHITE MTNS INS GROUP LTD 23/05/2013... (Bermuda) Ltd. Withhold WHITE MTNS INS GROUP LTD 23/05/2013... (Bermuda) Ltd. Withhold WHITE MTNS INS GROUP LTD 23/05/2013... (Bermuda) Ltd. Withhold WHITE MTNS INS GROUP LTD 23/05/2013... 602 Withhold Withhold WHITE MTNS INS GROUP LTD 23/05/2013... auditor's report Withhold WHITE MTNS INS GROUP LTD 23/05/2013 AGM 9.03 WHITE MTNS INS GROUP LTD 23/05/2013... MTNS INS GROUP LTD WHITE MTNS INS GROUP LTD WHITE MTNS INS GROUP...